Lineage for d1f7wa_ (1f7w A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83977Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
  5. 83978Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)
  6. 83979Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 83980Species Escherichia coli [TaxId:562] [64386] (4 PDB entries)
  8. 83985Domain d1f7wa_: 1f7w A: [59679]

Details for d1f7wa_

PDB Entry: 1f7w (more details)

PDB Description: solution structure of c-terminal domain zipa

SCOP Domain Sequences for d1f7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7wa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana

SCOP Domain Coordinates for d1f7wa_:

Click to download the PDB-style file with coordinates for d1f7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7wa_: