Lineage for d1f7va3 (1f7v A:2-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957009Superfamily d.67.2: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55190] (1 family) (S)
  5. 2957010Family d.67.2.1: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55191] (1 protein)
  6. 2957011Protein Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain [55192] (2 species)
  7. 2957012Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55193] (3 PDB entries)
  8. 2957014Domain d1f7va3: 1f7v A:2-135 [59678]
    Other proteins in same PDB: d1f7va1, d1f7va2
    protein/RNA complex

Details for d1f7va3

PDB Entry: 1f7v (more details), 2.9 Å

PDB Description: crystal structure of yeast arginyl-trna synthetase complexed with the trnaarg
PDB Compounds: (A:) arginyl-tRNA synthetase

SCOPe Domain Sequences for d1f7va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7va3 d.67.2.1 (A:2-135) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
astanmisqlkklsiaepavakdshpdvnivdlmrnyisqelskisgvdsslifpalewt
ntmergdllipiprlrikganpkdlavqwaekfpcgdflekveangpfiqfffnpqflak
lvipdiltrkedyg

SCOPe Domain Coordinates for d1f7va3:

Click to download the PDB-style file with coordinates for d1f7va3.
(The format of our PDB-style files is described here.)

Timeline for d1f7va3: