Lineage for d1f7va2 (1f7v A:136-483)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590102Protein Arginyl-tRNA synthetase (ArgRS) [52392] (2 species)
  7. 1590103Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52393] (3 PDB entries)
  8. 1590105Domain d1f7va2: 1f7v A:136-483 [59677]
    Other proteins in same PDB: d1f7va1, d1f7va3
    protein/RNA complex

Details for d1f7va2

PDB Entry: 1f7v (more details), 2.9 Å

PDB Description: crystal structure of yeast arginyl-trna synthetase complexed with the trnaarg
PDB Compounds: (A:) arginyl-tRNA synthetase

SCOPe Domain Sequences for d1f7va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7va2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
scklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgwevirmnylgdwgkq
fgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipleqstngkareyfkrm
edgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskesmlkaidlfkekglt
hedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryekyhfdkmiyviasqq
dlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldnileetkekmhevmkk
nenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsfeg

SCOPe Domain Coordinates for d1f7va2:

Click to download the PDB-style file with coordinates for d1f7va2.
(The format of our PDB-style files is described here.)

Timeline for d1f7va2: