SCOPe 2.06: Domain d1f7ua2: 1f7u A:136-483

Lineage for d1f7ua2 (1f7u A:136-483)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Arginyl-tRNA synthetase (ArgRS) [52392] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52393] (3 PDB entries)

8. Domain d1f7ua2: 1f7u A:136-483 [59674]
   Other proteins in same PDB: d1f7ua1, d1f7ua3
   protein/RNA complex; complexed with arg, so4

Details for d1f7ua2

PDB Entry: 1f7u, 2.2 Å

PDB Description: crystal structure of the arginyl-trna synthetase complexed with the trna(arg) and l-arg

PDB Compounds: (A:) arginyl-tRNA synthetase

SCOPe Domain Sequences for d1f7ua2:

Sequence; same for both SEQRES and ATOM records:

>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
scklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgwevirmnylgdwgkq
fgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipleqstngkareyfkrm
edgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskesmlkaidlfkekglt
hedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryekyhfdkmiyviasqq
dlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldnileetkekmhevmkk
nenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsfeg

Timeline for d1f7ua2:

• d1f7ua2 first appeared in SCOP 1.57
  
• d1f7ua2 appears in SCOPe 2.05
  
• d1f7ua2 appears in SCOPe 2.07
  
• d1f7ua2 appears in the current release, SCOPe 2.08