Lineage for d1f7ua2 (1f7u A:136-483)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827435Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 827436Protein Arginyl-tRNA synthetase (ArgRS) [52392] (2 species)
  7. 827437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52393] (3 PDB entries)
  8. 827438Domain d1f7ua2: 1f7u A:136-483 [59674]
    Other proteins in same PDB: d1f7ua1, d1f7ua3
    complexed with 1ma, 1mg, 2mg, 5mc, 5mu, arg, dhu, m2g, psu, so4

Details for d1f7ua2

PDB Entry: 1f7u (more details), 2.2 Å

PDB Description: crystal structure of the arginyl-trna synthetase complexed with the trna(arg) and l-arg
PDB Compounds: (A:) arginyl-tRNA synthetase

SCOP Domain Sequences for d1f7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
scklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgwevirmnylgdwgkq
fgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipleqstngkareyfkrm
edgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskesmlkaidlfkekglt
hedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryekyhfdkmiyviasqq
dlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldnileetkekmhevmkk
nenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsfeg

SCOP Domain Coordinates for d1f7ua2:

Click to download the PDB-style file with coordinates for d1f7ua2.
(The format of our PDB-style files is described here.)

Timeline for d1f7ua2: