![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries) |
![]() | Domain d1f7ua1: 1f7u A:484-607 [59673] Other proteins in same PDB: d1f7ua2, d1f7ua3 protein/RNA complex; complexed with arg, so4 |
PDB Entry: 1f7u (more details), 2.2 Å
SCOPe Domain Sequences for d1f7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp verm
Timeline for d1f7ua1: