Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries) |
Domain d1f7ua1: 1f7u A:484-607 [59673] Other proteins in same PDB: d1f7ua2, d1f7ua3 complexed with 1ma, 1mg, 2mg, 5mc, 5mu, arg, dhu, m2g, psu, so4 |
PDB Entry: 1f7u (more details), 2.2 Å
SCOP Domain Sequences for d1f7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp verm
Timeline for d1f7ua1: