Lineage for d1f7ua1 (1f7u A:484-607)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280298Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 280299Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 280300Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 280301Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)
  7. 280302Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries)
  8. 280303Domain d1f7ua1: 1f7u A:484-607 [59673]
    Other proteins in same PDB: d1f7ua2, d1f7ua3
    complexed with 1ma, 1mg, 2mg, 5mc, 5mu, arg, dhu, m2g, psu, so4

Details for d1f7ua1

PDB Entry: 1f7u (more details), 2.2 Å

PDB Description: crystal structure of the arginyl-trna synthetase complexed with the trna(arg) and l-arg

SCOP Domain Sequences for d1f7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

SCOP Domain Coordinates for d1f7ua1:

Click to download the PDB-style file with coordinates for d1f7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1f7ua1: