Lineage for d1f7ua1 (1f7u A:484-607)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96910Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 96911Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 96912Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 96913Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)
  7. 96914Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries)
  8. 96915Domain d1f7ua1: 1f7u A:484-607 [59673]
    Other proteins in same PDB: d1f7ua2, d1f7ua3

Details for d1f7ua1

PDB Entry: 1f7u (more details), 2.2 Å

PDB Description: crystal structure of the arginyl-trna synthetase complexed with the trna(arg) and l-arg

SCOP Domain Sequences for d1f7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

SCOP Domain Coordinates for d1f7ua1:

Click to download the PDB-style file with coordinates for d1f7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1f7ua1: