Lineage for d1f7tf_ (1f7t F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335460Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 335461Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 335467Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to tose of IspF
  6. 335468Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 335469Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 335476Domain d1f7tf_: 1f7t F: [59672]
    complexed with cl, dtt, gol, na; mutant

Details for d1f7tf_

PDB Entry: 1f7t (more details), 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a

SCOP Domain Sequences for d1f7tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7tf_ d.150.1.2 (F:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvierl

SCOP Domain Coordinates for d1f7tf_:

Click to download the PDB-style file with coordinates for d1f7tf_.
(The format of our PDB-style files is described here.)

Timeline for d1f7tf_: