Lineage for d1f7tb_ (1f7t B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437357Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1437358Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1437364Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
    automatically mapped to Pfam PF01648
  6. 1437365Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 1437366Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 1437369Domain d1f7tb_: 1f7t B: [59668]
    complexed with cl, dtt, gol, na

Details for d1f7tb_

PDB Entry: 1f7t (more details), 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a
PDB Compounds: (B:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f7tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7tb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
ggiygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakea
fskafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier

SCOPe Domain Coordinates for d1f7tb_:

Click to download the PDB-style file with coordinates for d1f7tb_.
(The format of our PDB-style files is described here.)

Timeline for d1f7tb_: