Lineage for d1f7tb_ (1f7t B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84726Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
  4. 84727Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
  5. 84733Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
  6. 84734Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 84735Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 84738Domain d1f7tb_: 1f7t B: [59668]

Details for d1f7tb_

PDB Entry: 1f7t (more details), 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a
PDB Compounds: (B:)

SCOP Domain Sequences for d1f7tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7tb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
ggiygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakea
fskafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier

SCOP Domain Coordinates for d1f7tb_:

Click to download the PDB-style file with coordinates for d1f7tb_.
(The format of our PDB-style files is described here.)

Timeline for d1f7tb_: