Lineage for d1f7la_ (1f7l A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224218Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2224219Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2224229Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
    automatically mapped to Pfam PF01648
  6. 2224230Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 2224231Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 2224232Domain d1f7la_: 1f7l A: [59666]
    complexed with ca, cl, coa

Details for d1f7la_

PDB Entry: 1f7l (more details), 1.5 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with coenzyme a at 1.5a
PDB Compounds: (A:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7la_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier

SCOPe Domain Coordinates for d1f7la_:

Click to download the PDB-style file with coordinates for d1f7la_.
(The format of our PDB-style files is described here.)

Timeline for d1f7la_: