SCOP 1.67: Domain d1f75b_: 1f75 B:

Lineage for d1f75b_ (1f75 B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)

6. Protein Undecaprenyl diphosphate synthase [64007] (2 species)

7. Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry)

8. Domain d1f75b_: 1f75 B: [59663]
   complexed with so4; mutant

Details for d1f75b_

PDB Entry: 1f75, 2.2 Å

PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26

SCOP Domain Sequences for d1f75b_:

Sequence, based on SEQRES records:

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafstenw
srpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhnt
gltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirt
sgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Sequence, based on observed residues (ATOM records):

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafnylmk
lpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfalnygg
rkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerlsnfliw
qcsysefvfidefwpdfneeslaqcisiyqnr

Timeline for d1f75b_:

• d1f75b_ first appeared in SCOP 1.57
  
• d1f75b_ appears in SCOP 1.65
  
• d1f75b_ appears in SCOP 1.69
  
• d1f75b_ appears in the current release, SCOPe 2.08