Lineage for d1f75a_ (1f75 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) 
Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein) Protein Undecaprenyl diphosphate synthase [64007] (2 species) 
Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry) 
Domain d1f75a_: 1f75 A: [59662]
Details for d1f75a_
PDB Entry: 1f75 (more details), 2.2 Å
PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26
SCOP Domain Sequences for d1f75a_:
Sequence, based on SEQRES records: (download)
>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
stenwsrpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakek
tkhntgltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpe
llirtsgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr
Sequence, based on observed residues (ATOM records): (download)
>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
nylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfa
lnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerls
nfliwqcsysefvfidefwpdfneeslaqcisiyqnr
SCOP Domain Coordinates for d1f75a_:
Click to download the PDB-style file with coordinates for d1f75a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f75a_:
- d1f75a_ first appeared in SCOP 1.57
- d1f75a_ appears in SCOP 1.59
- d1f75a_ appears in SCOP 1.63
- d1f75a_ appears in the current release, SCOPe 2.08
View in 3D
