SCOPe 2.08: Domain d1f75a_: 1f75 A:

Lineage for d1f75a_ (1f75 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry)

8. Domain d1f75a_: 1f75 A: [59662]
   complexed with so4

Details for d1f75a_

PDB Entry: 1f75, 2.2 Å

PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26

PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d1f75a_:

Sequence, based on SEQRES records:

>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
stenwsrpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakek
tkhntgltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpe
llirtsgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Sequence, based on observed residues (ATOM records):

>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
nylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfa
lnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerls
nfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Timeline for d1f75a_:

• d1f75a_ first appeared in SCOP 1.57
  
• d1f75a_ appears in SCOPe 2.07