Lineage for d1f6nm_ (1f6n M:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457881Protein M (medium) subunit [81481] (3 species)
  7. 1457882Species Rhodobacter sphaeroides [TaxId:1063] [81479] (55 PDB entries)
    Uniprot P02953
  8. 1457930Domain d1f6nm_: 1f6n M: [59661]
    Other proteins in same PDB: d1f6nh1, d1f6nh2, d1f6nl_
    complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1f6nm_

PDB Entry: 1f6n (more details), 2.8 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1f6nm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6nm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d1f6nm_:

Click to download the PDB-style file with coordinates for d1f6nm_.
(The format of our PDB-style files is described here.)

Timeline for d1f6nm_: