Lineage for d1f6nh1 (1f6n H:36-250)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401018Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2401019Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2401020Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2401021Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2401022Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries)
    Uniprot P11846
  8. 2401094Domain d1f6nh1: 1f6n H:36-250 [59658]
    Other proteins in same PDB: d1f6nh2, d1f6nl_, d1f6nm_
    complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1f6nh1

PDB Entry: 1f6n (more details), 2.8 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1f6nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6nh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d1f6nh1:

Click to download the PDB-style file with coordinates for d1f6nh1.
(The format of our PDB-style files is described here.)

Timeline for d1f6nh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f6nh2