Lineage for d1f5la_ (1f5l A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057409Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2057410Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2057456Domain d1f5la_: 1f5l A: [59653]
    complexed with amr, so4

Details for d1f5la_

PDB Entry: 1f5l (more details), 2.1 Å

PDB Description: urokinase plasminogen activator b-chain-amiloride complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1f5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5la_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOPe Domain Coordinates for d1f5la_:

Click to download the PDB-style file with coordinates for d1f5la_.
(The format of our PDB-style files is described here.)

Timeline for d1f5la_: