Lineage for d1f4la2 (1f4l A:4-140,A:176-388)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693440Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 693441Species Escherichia coli [TaxId:562] [52386] (9 PDB entries)
  8. 693446Domain d1f4la2: 1f4l A:4-140,A:176-388 [59649]
    Other proteins in same PDB: d1f4la1, d1f4la3
    complexed with met, zn

Details for d1f4la2

PDB Entry: 1f4l (more details), 1.85 Å

PDB Description: crystal structure of the e.coli methionyl-trna synthetase complexed with methionine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOP Domain Sequences for d1f4la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4la2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
isqlydpekgmflpdrfXvvsgatpvmrdsehfffdlpsfsemlqawtrsgalqeqvank
mqewfesglqqwdisrdapyfgfeipnapgkyfyvwldapigymgsfknlcdkrgdsvsf
deywkkdstaelyhfigkdivyfhslfwpamlegsnfrkpsnlfvhgyvtvngakmsksr
gtfikastwlnhfdadslryyytaklssriddidlnledfvqrvnadivnk

SCOP Domain Coordinates for d1f4la2:

Click to download the PDB-style file with coordinates for d1f4la2.
(The format of our PDB-style files is described here.)

Timeline for d1f4la2: