Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) contains a single copy of this fold automatically mapped to Pfam PF04354 |
Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins) |
Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species) |
Species Escherichia coli [TaxId:562] [64386] (6 PDB entries) |
Domain d1f47b_: 1f47 B: [59645] complexed with an FtsZ fragment |
PDB Entry: 1f47 (more details), 1.95 Å
SCOPe Domain Sequences for d1f47b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f47b_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]} mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq rrmmtpqklreyqdiirevkdana
Timeline for d1f47b_: