SCOPe 2.03: Domain d1f47b_: 1f47 B:

Lineage for d1f47b_ (1f47 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold
   automatically mapped to Pfam PF04354

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)

6. Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)

7. Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)

8. Domain d1f47b_: 1f47 B: [59645]
   complexed with an FtsZ fragment

Details for d1f47b_

PDB Entry: 1f47, 1.95 Å

PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography

PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1f47b_:

Sequence; same for both SEQRES and ATOM records:

>d1f47b_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana

Timeline for d1f47b_:

• d1f47b_ first appeared in SCOP 1.57
  
• d1f47b_ appears in SCOPe 2.02
  
• d1f47b_ appears in SCOPe 2.04
  
• d1f47b_ appears in the current release, SCOPe 2.08