Lineage for d1f47b_ (1f47 B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) 
Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein) Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species) Species Escherichia coli [TaxId:562] [64386] (4 PDB entries) 
Domain d1f47b_: 1f47 B: [59645]
Details for d1f47b_
PDB Entry: 1f47 (more details), 1.95 Å
PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
SCOP Domain Sequences for d1f47b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f47b_ d.129.4.1 (B:) Cell-division protein ZipA, C-terminal domain {Escherichia coli}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana
SCOP Domain Coordinates for d1f47b_:
Click to download the PDB-style file with coordinates for d1f47b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f47b_:
- d1f47b_ is new in SCOP 1.57
- d1f47b_ appears in SCOP 1.59
- d1f47b_ appears in the current release, SCOPe 2.08
View in 3D