Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Heterodimeric interleukin-12 alpha chain [63530] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63531] (1 PDB entry) |
Domain d1f45b_: 1f45 B: [59642] Other proteins in same PDB: d1f45a1, d1f45a2, d1f45a3 |
PDB Entry: 1f45 (more details), 2.8 Å
SCOPe Domain Sequences for d1f45b_:
Sequence, based on SEQRES records: (download)
>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens) [TaxId: 9606]} qnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltknesclnsre tsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnmla videlmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvmsylnas
>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens) [TaxId: 9606]} qnllravsnmlqkarqtlefypcstveaclpleltknesctsfitngssfmmalclssiy edlkmyqvefktmnakllmdpkrqifldqnmlavidelmqalyktkiklcillhafrira vtidrvmsylnas
Timeline for d1f45b_: