![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (9 proteins) |
![]() | Protein Heterodimeric interleukin-12 alpha chain [63530] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63531] (1 PDB entry) |
![]() | Domain d1f45b_: 1f45 B: [59642] Other proteins in same PDB: d1f45a1, d1f45a2, d1f45a3 complexed with man, nag; mutant |
PDB Entry: 1f45 (more details), 2.8 Å
SCOP Domain Sequences for d1f45b_:
Sequence, based on SEQRES records: (download)
>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens) [TaxId: 9606]} qnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltknesclnsre tsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnmla videlmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvmsylnas
>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens) [TaxId: 9606]} qnllravsnmlqkarqtlefypcstveaclpleltknesctsfitngssfmmalclssiy edlkmyqvefktmnakllmdpkrqifldqnmlavidelmqalyktkiklcillhafrira vtidrvmsylnas
Timeline for d1f45b_: