Lineage for d1f45a3 (1f45 A:212-306)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 161110Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 161111Species Human (Homo sapiens) [TaxId:9606] [63673] (2 PDB entries)
  8. 161115Domain d1f45a3: 1f45 A:212-306 [59641]
    Other proteins in same PDB: d1f45a1, d1f45b_

Details for d1f45a3

PDB Entry: 1f45 (more details), 2.8 Å

PDB Description: human interleukin-12

SCOP Domain Sequences for d1f45a3:

Sequence, based on SEQRES records: (download)

>d1f45a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpcs

Sequence, based on observed residues (ATOM records): (download)

>d1f45a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqkdrvftdktsatvic
rsisvraqdryyssswsewasvpcs

SCOP Domain Coordinates for d1f45a3:

Click to download the PDB-style file with coordinates for d1f45a3.
(The format of our PDB-style files is described here.)

Timeline for d1f45a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f45b_