Lineage for d1f42a2 (1f42 A:88-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657580Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 657581Species Human (Homo sapiens) [TaxId:9606] [63673] (2 PDB entries)
  8. 657582Domain d1f42a2: 1f42 A:88-211 [59637]
    Other proteins in same PDB: d1f42a1

Details for d1f42a2

PDB Entry: 1f42 (more details), 2.5 Å

PDB Description: the p40 domain of human interleukin-12
PDB Compounds: (A:) interleukin-12 beta chain

SCOP Domain Sequences for d1f42a2:

Sequence, based on SEQRES records: (download)

>d1f42a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi
rdii

Sequence, based on observed residues (ATOM records): (download)

>d1f42a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrggvtcgaat
lsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii

SCOP Domain Coordinates for d1f42a2:

Click to download the PDB-style file with coordinates for d1f42a2.
(The format of our PDB-style files is described here.)

Timeline for d1f42a2: