Lineage for d1f42a2 (1f42 A:88-211)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 551065Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 551066Species Human (Homo sapiens) [TaxId:9606] [63673] (2 PDB entries)
  8. 551067Domain d1f42a2: 1f42 A:88-211 [59637]
    Other proteins in same PDB: d1f42a1

Details for d1f42a2

PDB Entry: 1f42 (more details), 2.5 Å

PDB Description: the p40 domain of human interleukin-12

SCOP Domain Sequences for d1f42a2:

Sequence, based on SEQRES records: (download)

>d1f42a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi
rdii

Sequence, based on observed residues (ATOM records): (download)

>d1f42a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrggvtcgaat
lsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii

SCOP Domain Coordinates for d1f42a2:

Click to download the PDB-style file with coordinates for d1f42a2.
(The format of our PDB-style files is described here.)

Timeline for d1f42a2: