Lineage for d1f42a1 (1f42 A:1-87)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 657151Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)
  7. 657152Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries)
  8. 657153Domain d1f42a1: 1f42 A:1-87 [59636]
    Other proteins in same PDB: d1f42a2, d1f42a3
    complexed with man, mnb, nag

Details for d1f42a1

PDB Entry: 1f42 (more details), 2.5 Å

PDB Description: the p40 domain of human interleukin-12
PDB Compounds: (A:) interleukin-12 beta chain

SCOP Domain Sequences for d1f42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f42a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

SCOP Domain Coordinates for d1f42a1:

Click to download the PDB-style file with coordinates for d1f42a1.
(The format of our PDB-style files is described here.)

Timeline for d1f42a1: