![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (36 proteins) |
![]() | Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries) |
![]() | Domain d1f42a1: 1f42 A:1-87 [59636] Other proteins in same PDB: d1f42a2, d1f42a3 complexed with man, mnb, nag |
PDB Entry: 1f42 (more details), 2.5 Å
SCOP Domain Sequences for d1f42a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f42a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef gdagqytchkggevlshsllllhkked
Timeline for d1f42a1: