SCOP 1.69: Domain d1f42a1: 1f42 A:1-87

Lineage for d1f42a1 (1f42 A:1-87)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries)

8. Domain d1f42a1: 1f42 A:1-87 [59636]
   Other proteins in same PDB: d1f42a2, d1f42a3

Details for d1f42a1

PDB Entry: 1f42, 2.5 Å

PDB Description: the p40 domain of human interleukin-12

SCOP Domain Sequences for d1f42a1:

Sequence; same for both SEQRES and ATOM records:

>d1f42a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens)}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

Timeline for d1f42a1:

• d1f42a1 first appeared in SCOP 1.57
  
• d1f42a1 appears in SCOP 1.67
  
• d1f42a1 appears in SCOP 1.71
  
• d1f42a1 appears in the current release, SCOPe 2.08