Lineage for d1f42a1 (1f42 A:1-87)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (22 proteins) 
Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain [63665] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries) 
Domain d1f42a1: 1f42 A:1-87 [59636]
Other proteins in same PDB: d1f42a2, d1f42a3
Details for d1f42a1
PDB Entry: 1f42 (more details), 2.5 Å
PDB Description: the p40 domain of human interleukin-12
SCOP Domain Sequences for d1f42a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f42a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain {Human (Homo sapiens)}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked
SCOP Domain Coordinates for d1f42a1:
Click to download the PDB-style file with coordinates for d1f42a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f42a1:
- d1f42a1 is new in SCOP 1.57
- d1f42a1 appears in SCOP 1.59
- d1f42a1 appears in the current release, SCOPe 2.08
View in 3D
