![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (16 proteins) |
![]() | Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species) |
![]() | Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries) |
![]() | Domain d1f3ya_: 1f3y A: [59635] mutant |
PDB Entry: 1f3y (more details)
SCOP Domain Sequences for d1f3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ya_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl
Timeline for d1f3ya_: