Lineage for d1f3ya_ (1f3y A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 731931Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 731990Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 731999Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries)
  8. 732000Domain d1f3ya_: 1f3y A: [59635]
    mutant

Details for d1f3ya_

PDB Entry: 1f3y (more details)

PDB Description: solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius l.
PDB Compounds: (A:) diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase

SCOP Domain Sequences for d1f3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ya_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire
lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein
llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl

SCOP Domain Coordinates for d1f3ya_:

Click to download the PDB-style file with coordinates for d1f3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1f3ya_: