Lineage for d1f3pa3 (1f3p A:309-400)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204290Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2204291Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2204404Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)
  7. 2204405Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)
  8. 2204415Domain d1f3pa3: 1f3p A:309-400 [59634]
    Other proteins in same PDB: d1f3pa1, d1f3pa2, d1f3pa4
    complexed with fad, nad

Details for d1f3pa3

PDB Entry: 1f3p (more details), 2.4 Å

PDB Description: ferredoxin reductase (bpha4)-nadh complex
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d1f3pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3pa3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr

SCOPe Domain Coordinates for d1f3pa3:

Click to download the PDB-style file with coordinates for d1f3pa3.
(The format of our PDB-style files is described here.)

Timeline for d1f3pa3: