Lineage for d1f3pa3 (1f3p A:309-405)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 82071Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)
  7. 82072Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (2 PDB entries)
  8. 82074Domain d1f3pa3: 1f3p A:309-405 [59634]
    Other proteins in same PDB: d1f3pa1, d1f3pa2

Details for d1f3pa3

PDB Entry: 1f3p (more details), 2.4 Å

PDB Description: ferredoxin reductase (bpha4)-nadh complex

SCOP Domain Sequences for d1f3pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3pa3 d.87.1.1 (A:309-405) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlrklaaa

SCOP Domain Coordinates for d1f3pa3:

Click to download the PDB-style file with coordinates for d1f3pa3.
(The format of our PDB-style files is described here.)

Timeline for d1f3pa3: