Lineage for d1f3pa2 (1f3p A:116-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458417Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)
  7. 2458418Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (9 PDB entries)
  8. 2458438Domain d1f3pa2: 1f3p A:116-236 [59633]
    Other proteins in same PDB: d1f3pa3, d1f3pa4
    complexed with fad, nad

Details for d1f3pa2

PDB Entry: 1f3p (more details), 2.4 Å

PDB Description: ferredoxin reductase (bpha4)-nadh complex
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d1f3pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3pa2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

SCOPe Domain Coordinates for d1f3pa2:

Click to download the PDB-style file with coordinates for d1f3pa2.
(The format of our PDB-style files is described here.)

Timeline for d1f3pa2: