Lineage for d1f3pa1 (1f3p A:5-115,A:237-308)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67376Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)
  7. 67377Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (2 PDB entries)
  8. 67380Domain d1f3pa1: 1f3p A:5-115,A:237-308 [59632]
    Other proteins in same PDB: d1f3pa3

Details for d1f3pa1

PDB Entry: 1f3p (more details), 2.4 Å

PDB Description: ferredoxin reductase (bpha4)-nadh complex

SCOP Domain Sequences for d1f3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3pa1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102}
alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki
rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapraXvlandala
raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh
lvdp

SCOP Domain Coordinates for d1f3pa1:

Click to download the PDB-style file with coordinates for d1f3pa1.
(The format of our PDB-style files is described here.)

Timeline for d1f3pa1: