Lineage for d1f3la_ (1f3l A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72963Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 72964Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (13 families) (S)
  5. 72997Family c.66.1.6: Arginine methyltransferase, HMT1 [53351] (1 protein)
  6. 72998Protein Arginine methyltransferase, HMT1 [53352] (2 species)
  7. 73006Species Rat (Rattus norvegicus) [TaxId:10116] [64116] (1 PDB entry)
  8. 73007Domain d1f3la_: 1f3l A: [59630]

Details for d1f3la_

PDB Entry: 1f3l (more details), 2.03 Å

PDB Description: crystal structure of the conserved core of protein arginine methyltransferase prmt3

SCOP Domain Sequences for d1f3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3la_ c.66.1.6 (A:) Arginine methyltransferase, HMT1 {Rat (Rattus norvegicus)}
dlqededgvyfssyghygiheemlkdkvrtesyrdfiyqnphifkdkvvldvgcgtgils
mfaakagakkviavdqseilyqamdiirlnkledtivlikgkieevslpvekvdviisew
mgyfllfesmldsvlyakskylakggsvypdictislvavsdvskhadriafwddvygfn
mscmkkavipeavvevvdhktlisdpcdikhidchttsisdlefssdftlrttktamcta
vagyfdiyfeknchnrvvfstgpqstkthwkqtifllekpfpvkagealkgkitvhknkk
dprslivtltlnsstqtyslq

SCOP Domain Coordinates for d1f3la_:

Click to download the PDB-style file with coordinates for d1f3la_.
(The format of our PDB-style files is described here.)

Timeline for d1f3la_: