Lineage for d1f35a_ (1f35 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408072Fold b.94: Olfactory marker protein [63696] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2408073Superfamily b.94.1: Olfactory marker protein [63697] (1 family) (S)
    automatically mapped to Pfam PF06554
  5. 2408074Family b.94.1.1: Olfactory marker protein [63698] (1 protein)
  6. 2408075Protein Olfactory marker protein [63699] (2 species)
  7. 2408076Species Mouse (Mus musculus) [TaxId:10090] [63700] (3 PDB entries)
  8. 2408077Domain d1f35a_: 1f35 A: [59628]
    CASP4
    complexed with cac, zn

Details for d1f35a_

PDB Entry: 1f35 (more details), 2.3 Å

PDB Description: crystal structure of murine olfactory marker protein
PDB Compounds: (A:) Olfactory Marker Protein

SCOPe Domain Sequences for d1f35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f35a_ b.94.1.1 (A:) Olfactory marker protein {Mouse (Mus musculus) [TaxId: 10090]}
aedgpqkqqlemplvldqdltqqmrlrveslkqrgekkqdgeklirpaesvyrldfiqqq
klqfdhwnvvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwnead
alefgerlsdlakirkvmyflitfgegvepanlkasvvfnql

SCOPe Domain Coordinates for d1f35a_:

Click to download the PDB-style file with coordinates for d1f35a_.
(The format of our PDB-style files is described here.)

Timeline for d1f35a_: