SCOPe 2.06: Domain d1f2oa_: 1f2o A:

Lineage for d1f2oa_ (1f2o A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)

8. Domain d1f2oa_: 1f2o A: [59625]
   complexed with ca, leu, zn

Details for d1f2oa_

PDB Entry: 1f2o, 1.7 Å

PDB Description: crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine

PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1f2oa_:

Sequence; same for both SEQRES and ATOM records:

>d1f2oa_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Timeline for d1f2oa_:

• d1f2oa_ first appeared in SCOP 1.57
  
• d1f2oa_ appears in SCOPe 2.05
  
• d1f2oa_ appears in SCOPe 2.07
  
• d1f2oa_ appears in the current release, SCOPe 2.08