SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1f2oa_ (1f2o A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126919Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 protein domains)
  6. 2126930Protein Aminopeptidase [53205] (2 species)
  7. 2126949Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 2126952Domain d1f2oa_: 1f2o A: [59625]
    complexed with ca, leu, zn

Details for d1f2oa_

PDB Entry: 1f2o (more details), 1.7 Å

PDB Description: crystal structure of the streptomyces griseus aminopeptidase complexed with l-leucine
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1f2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2oa_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

SCOPe Domain Coordinates for d1f2oa_:

Click to download the PDB-style file with coordinates for d1f2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f2oa_: