SCOPe 2.07: Domain d1f2ha_: 1f2h A:

Lineage for d1f2ha_ (1f2h A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.22: TRADD, N-terminal domain [55044] (1 family)

5. Family d.58.22.1: TRADD, N-terminal domain [55045] (1 protein)

6. Protein TRADD, N-terminal domain [55046] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55047] (2 PDB entries)

8. Domain d1f2ha_: 1f2h A: [59612]

Details for d1f2ha_

PDB Entry: 1f2h

PDB Description: solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.

PDB Compounds: (A:) tumor necrosis factor receptor type 1 associated death domain protein

SCOPe Domain Sequences for d1f2ha_:

Sequence; same for both SEQRES and ATOM records:

>d1f2ha_ d.58.22.1 (A:) TRADD, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
maagqngheewvgsaylfvessldkvvlsdayahpqqkvavyralqaalaesggspdvlq
mlkihrsdpqlivqlrfcgrqpcgrflrayregalraalqrslaaalaqhsvplqlelra
gaerldalladeerclscilaqqpdrlrdeelaeledalrnlkcgsgar

Timeline for d1f2ha_:

• d1f2ha_ first appeared in SCOP 1.57
  
• d1f2ha_ appears in SCOPe 2.06
  
• d1f2ha_ appears in the current release, SCOPe 2.08