Lineage for d1f28d_ (1f28 D:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136942Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 136943Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 136944Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 136956Protein Thymidylate synthase [55833] (7 species)
  7. 137098Species Pneumocystis carinii [TaxId:4754] [55838] (2 PDB entries)
  8. 137102Domain d1f28d_: 1f28 D: [59611]

Details for d1f28d_

PDB Entry: 1f28 (more details), 1.9 Å

PDB Description: crystal structure of thymidylate synthase from pneumocystis carinii bound to dump and bw1843u89

SCOP Domain Sequences for d1f28d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f28d_ d.117.1.1 (D:) Thymidylate synthase {Pneumocystis carinii}
naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi

SCOP Domain Coordinates for d1f28d_:

Click to download the PDB-style file with coordinates for d1f28d_.
(The format of our PDB-style files is described here.)

Timeline for d1f28d_: