Lineage for d1f28d_ (1f28 D:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Pneumocystis carinii [TaxId:4754] [55838] (2 PDB entries) 
Domain d1f28d_: 1f28 D: [59611]
Details for d1f28d_
PDB Entry: 1f28 (more details), 1.9 Å
PDB Description: crystal structure of thymidylate synthase from pneumocystis carinii bound to dump and bw1843u89
SCOP Domain Sequences for d1f28d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f28d_ d.117.1.1 (D:) Thymidylate synthase {Pneumocystis carinii}
naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
SCOP Domain Coordinates for d1f28d_:
Click to download the PDB-style file with coordinates for d1f28d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f28d_:
- d1f28d_ is new in SCOP 1.57
- d1f28d_ appears in SCOP 1.59
- d1f28d_ appears in the current release, SCOPe 2.08
View in 3D
