Lineage for d1f28b_ (1f28 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212247Species Fungus (Pneumocystis carinii) [TaxId:4754] [55838] (2 PDB entries)
  8. 2212249Domain d1f28b_: 1f28 B: [59609]
    complexed with f89, ump

Details for d1f28b_

PDB Entry: 1f28 (more details), 1.9 Å

PDB Description: crystal structure of thymidylate synthase from pneumocystis carinii bound to dump and bw1843u89
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1f28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f28b_ d.117.1.1 (B:) Thymidylate synthase {Fungus (Pneumocystis carinii) [TaxId: 4754]}
naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi

SCOPe Domain Coordinates for d1f28b_:

Click to download the PDB-style file with coordinates for d1f28b_.
(The format of our PDB-style files is described here.)

Timeline for d1f28b_: