SCOP 1.75: Domain d1f23f_: 1f23 F:

Lineage for d1f23f_ (1f23 F:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (22 PDB entries)

8. Domain d1f23f_: 1f23 F: [59607]

Details for d1f23f_

PDB Entry: 1f23, 2.3 Å

PDB Description: contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function

PDB Compounds: (F:) transmembrane glycoprotein

SCOP Domain Sequences for d1f23f_:

Sequence, based on SEQRES records:

>d1f23f_ h.3.2.1 (F:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
ieesqnqqekneqell

Sequence, based on observed residues (ATOM records):

>d1f23f_ h.3.2.1 (F:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgtkqlqarilrggwmewdreinnytslihsliee
sqnqqekneqell

Timeline for d1f23f_:

• d1f23f_ first appeared in SCOP 1.57
  
• d1f23f_ appears in SCOP 1.73
  
• d1f23f_ appears in SCOPe 2.01
  
• d1f23f_ appears in the current release, SCOPe 2.08