Lineage for d1f1md_ (1f1m D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46699Superfamily a.24.12: Outer surface protein C (OspC) [63515] (1 family) (S)
  5. 46700Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)
  6. 46701Protein Outer surface protein C (OspC) [63517] (1 species)
  7. 46702Species Lyme disease spirochete (Borrelia burgdorferi), different strains? [63518] (3 PDB entries)
  8. 46706Domain d1f1md_: 1f1m D: [59601]

Details for d1f1md_

PDB Entry: 1f1m (more details), 1.8 Å

PDB Description: crystal structure of outer surface protein c (ospc)

SCOP Domain Sequences for d1f1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1md_ a.24.12.1 (D:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains?}
pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
lktnndktkgadeleklfesvknlskaakemltnsvkeltsp

SCOP Domain Coordinates for d1f1md_:

Click to download the PDB-style file with coordinates for d1f1md_.
(The format of our PDB-style files is described here.)

Timeline for d1f1md_: