Lineage for d1f1md_ (1f1m D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700279Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families) (S)
  5. 2700280Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)
    automatically mapped to Pfam PF01441
  6. 2700281Protein Outer surface protein C (OspC) [63517] (1 species)
  7. 2700282Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)
  8. 2700286Domain d1f1md_: 1f1m D: [59601]
    complexed with zn

Details for d1f1md_

PDB Entry: 1f1m (more details), 1.8 Å

PDB Description: crystal structure of outer surface protein c (ospc)
PDB Compounds: (D:) outer surface protein c

SCOPe Domain Sequences for d1f1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1md_ a.24.12.1 (D:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
lktnndktkgadeleklfesvknlskaakemltnsvkeltsp

SCOPe Domain Coordinates for d1f1md_:

Click to download the PDB-style file with coordinates for d1f1md_.
(The format of our PDB-style files is described here.)

Timeline for d1f1md_: