![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families) ![]() |
![]() | Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein) automatically mapped to Pfam PF01441 |
![]() | Protein Outer surface protein C (OspC) [63517] (1 species) |
![]() | Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries) |
![]() | Domain d1f1mc_: 1f1m C: [59600] complexed with zn |
PDB Entry: 1f1m (more details), 1.8 Å
SCOPe Domain Sequences for d1f1mc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1mc_ a.24.12.1 (C:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]} pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai lktnndktkgadeleklfesvknlskaakemltnsvkeltsp
Timeline for d1f1mc_: