Lineage for d1f1mb_ (1f1m B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988942Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families) (S)
  5. 1988943Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)
    automatically mapped to Pfam PF01441
  6. 1988944Protein Outer surface protein C (OspC) [63517] (1 species)
  7. 1988945Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)
  8. 1988947Domain d1f1mb_: 1f1m B: [59599]
    complexed with zn

Details for d1f1mb_

PDB Entry: 1f1m (more details), 1.8 Å

PDB Description: crystal structure of outer surface protein c (ospc)
PDB Compounds: (B:) outer surface protein c

SCOPe Domain Sequences for d1f1mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1mb_ a.24.12.1 (B:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
lktnndktkgadeleklfesvknlskaakemltnsvkeltsp

SCOPe Domain Coordinates for d1f1mb_:

Click to download the PDB-style file with coordinates for d1f1mb_.
(The format of our PDB-style files is described here.)

Timeline for d1f1mb_: