SCOPe 2.05: Domain d1f1mb_: 1f1m B:

Lineage for d1f1mb_ (1f1m B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families)

5. Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)
   automatically mapped to Pfam PF01441

6. Protein Outer surface protein C (OspC) [63517] (1 species)

7. Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)

8. Domain d1f1mb_: 1f1m B: [59599]
   complexed with zn

Details for d1f1mb_

PDB Entry: 1f1m, 1.8 Å

PDB Description: crystal structure of outer surface protein c (ospc)

PDB Compounds: (B:) outer surface protein c

SCOPe Domain Sequences for d1f1mb_:

Sequence; same for both SEQRES and ATOM records:

>d1f1mb_ a.24.12.1 (B:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
lktnndktkgadeleklfesvknlskaakemltnsvkeltsp

Timeline for d1f1mb_:

• d1f1mb_ first appeared in SCOP 1.57
  
• d1f1mb_ appears in SCOPe 2.04
  
• d1f1mb_ appears in SCOPe 2.06
  
• d1f1mb_ appears in the current release, SCOPe 2.08